PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00120845001
Common NameGSBRNA2T00120845001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 447aa    MW: 48982.2 Da    PI: 7.5157
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00120845001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.81.1e-27178230356
              G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          +++WtpeLH+rFveaveqL G ekA+P++ilelm+v++Lt+++v+SHLQkYR++
  GSBRNA2T00120845001 178 KVDWTPELHRRFVEAVEQL-GLEKAVPSRILELMGVHCLTRHNVASHLQKYRSH 230
                          789****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.918173232IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-26178233IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-25178230IPR006447Myb domain, plants
SuperFamilySSF466893.23E-17179233IPR009057Homeodomain-like
PfamPF002498.2E-8179228IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MLALSPARNS TRDDGESEFL ATSCGFSINP EEDFPEFAVH GDLLDIIDFD DLFGVAGDVL  60
PDLEMDPEIL GGELSDHMNA SSTITTTTSS SEKTKSQGKA NNKKGISGKG EEVVSKRDHN  120
ETPVAETVVN YDGDSGRKRS HSSSGSTKRN PISNNEGKRK VKNHIENKII MFITPFYKVD  180
WTPELHRRFV EAVEQLGLEK AVPSRILELM GVHCLTRHNV ASHLQKYRSH RKHLLAREAE  240
AANWTRKRHI YGLDSTGANA NGRNRNGWLA PAPTLGYPPP PPAAVASPPV HHHHLRPLHV  300
WGHPTVDQSV MPHVWPKHLP PPSTAMATPP FWVSDTPYWP RIHNGTTPYL PTVATRFRTP  360
PVAGIPQALP SHHMVNNYKP DHGFGGPRSL VDLHPSKESV DAAIGDVLTR PWLPLPLGLK  420
PPTVDGVITE LHRHGVSDVP PAASCA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-14178228757ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.240504e-84vegetative meristem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00120845001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013675958.10.0PREDICTED: transcription activator GLK1-like isoform X1
SwissprotQ9SIV30.0GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A078F1P60.0A0A078F1P6_BRANA; BnaC07g00300D protein
STRINGBra036482.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.21e-173GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]